Recombinant Mouse Ephrin-A4/EFNA4 Protein, Human

Catalog Number: ABB-RP03100
Article Name: Recombinant Mouse Ephrin-A4/EFNA4 Protein, Human
Biozol Catalog Number: ABB-RP03100
Supplier Catalog Number: RP03100
Alternative Catalog Number: ABB-RP03100-20UG, ABB-RP03100-50UG, ABB-RP03100-100UG, ABB-RP03100-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Leu26 - Gly176
Alternative Names: Efna4, Epl4, Eplg4, Lerk4
EPH-related receptor tyrosine kinase ligand 4 (Ephrin-A4) also known as EFNA4, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. Ephrin-A4/EFNA4 functions as a cell surface GPI-bound ligand for Eph receptor, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development.
Concentration: < 0.01 EU/µg of the protein by LAL method.
Molecular Weight: 43.67 kDa
NCBI: 13639
UniProt: O08542
Purity: 90% as determined by reducing SDS-PAGE.
Form: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Sequence: LRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG
Target: Efna4, Epl4, Eplg4, Lerk4
Application Dilute: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors