Recombinant Human EG-VEGF/PK1 Protein, Virus

Catalog Number: ABB-RP03103
Article Name: Recombinant Human EG-VEGF/PK1 Protein, Virus
Biozol Catalog Number: ABB-RP03103
Supplier Catalog Number: RP03103
Alternative Catalog Number: ABB-RP03103-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Phe105
Alternative Names: EG-VEGF, PK1, PRK1
EG-VEGF, also known as prokineticin-1, is a member of the AVIT (prokineticin) family. Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. EG-VEGF can be detected in the steroidogenic glands, ovary, testis, adrenal and placenta. EG-VEGF has little or no effect on a variety of other endothelial and non-endothelial cell types. It induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. EG-VEGF may play a role in placentation. It may also function in normal and pathological testis angiogenesis. It positively regulates PTGS2 expression and prostaglandin synthesis.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 11kDa
Tag: C-His
NCBI: 84432
UniProt: P58294
Source: Baculovirus-Insect Cells
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequence: MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Target: Prokineticin-1/EG-VEGF
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human EG-VEGF/PK1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.