Recombinant Mouse Galectin-3/LGALS3 Protein, Human

Catalog Number: ABB-RP03164
Article Name: Recombinant Mouse Galectin-3/LGALS3 Protein, Human
Biozol Catalog Number: ABB-RP03164
Supplier Catalog Number: RP03164
Alternative Catalog Number: ABB-RP03164-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Ala2-Ile264
Alternative Names: CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2,LGALS3,GAL3,GALBP,GALIG,L31,LGALS2,MAC2
Galectin-3 (Gal-3) is a 30 kDa beta-galactose, highly conserved and widely distributed intracellularly and extracellularly. Gal-3 has been demonstrated in recent years to be a novel inflammatory factor participating in the process of intravascular inflammation, lipid endocytosis, macrophage activation, cellular proliferation, monocyte chemotaxis, and cell adhesion.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 28.5 kDa.
Tag: C-His
NCBI: 16854
UniProt: Q8C253
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequence: ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITL
Target: Galectin-3/LGALS3
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein