Recombinant Human Tripeptidyl-peptidase 1/TPP1 Protein, Virus

Catalog Number: ABB-RP03205LQ
Article Name: Recombinant Human Tripeptidyl-peptidase 1/TPP1 Protein, Virus
Biozol Catalog Number: ABB-RP03205LQ
Supplier Catalog Number: RP03205LQ
Alternative Catalog Number: ABB-RP03205LQ-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ser20-Pro563
Alternative Names: Tripeptidyl-Peptidase 1, TPP-1, Cell Growth-Inhibiting Gene 1 Protein, Lysosomal Pepstatin-Insensitive Protease, LPIC, Tripeptidyl Aminopeptidase, Tripeptidyl-Peptidase I, TPP-I, TPP1, CLN2
Tripeptidyl-peptidase 1 (TPP1 / CLN2) is a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. TPP1 / CLN2 may act as a non-specific lysosomal peptidase which generates tripeptides from the breakdown products produced by lysosomal proteinases. Defects in TPP1 / CLN2 are the cause of neuronal ceroid lipofuscinosis type 2 (CLN2), a form of neuronal ceroid lipofuscinosis which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 60.7 kDa.
Tag: C-His
NCBI: 1200
UniProt: O14773
Source: Baculovirus-Insect Cells
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.22 µm filtered solution in 20mM Tris, 500mM NaCl, pH 7.4, 10% gly. Contact us for customized product form or formulation.
Sequence: SYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFLTCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEAS
Target: Tripeptidyl-peptidase 1/TPP1
Application Dilute: Supplied as a 0.22 µm filtered solution in 20mM Tris, 500mM NaCl, pH 7.4, 10% gly. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein