Recombinant Human Serglycin/SRGN Protein

Catalog Number: ABB-RP03237
Article Name: Recombinant Human Serglycin/SRGN Protein
Biozol Catalog Number: ABB-RP03237
Supplier Catalog Number: RP03237
Alternative Catalog Number: ABB-RP03237-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Tyr28-Leu158
Alternative Names: SRGN, PRG, PRG1
SRGN is known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of various hematopoietic cells has a protease-resistant peptide core, and is vital for neutralizing hydrolytic enzymes. SRGN is associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. It is required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. SRGN also plays a role in localizing neutrophil elastase in azurophil granules of neutrophils.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 16.1 KDa.
NCBI: 5552
UniProt: P10124
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: YPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
Target: Serglycin/SRGN
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human Serglycin/SRGN Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.