Recombinant Mouse Siglec-10 Protein, Human

Catalog Number: ABB-RP03262
Article Name: Recombinant Mouse Siglec-10 Protein, Human
Biozol Catalog Number: ABB-RP03262
Supplier Catalog Number: RP03262
Alternative Catalog Number: ABB-RP03262-50UG,ABB-RP03262-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Met19-Lys543
Alternative Names: SIGLEC10, SiglecG, Siglec-G, MGC126774, PRO940, Siglec10, SLG2, sialic acid-binding Ig-like lectin 10, Siglec-10, siglec-like gene 2, Siglec-like protein 2, SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7
Siglecs (sialic acid binding Ig-like lectins) belong to the immunoglobulin superfamily. Siglec-G is the apparent ortholog of human Siglec-10. It is expressed by mature B cells, but significant levels of transcript were also detected in DC, myeloid cells, and to a lesser extent, T cells. Mature Siglec-G consists of a 526 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 124 aa cytoplasmic domain. Siglec-G is a member of the CD33-related Siglec family in the mouse, and is involved in negative regulation of B-cell antigen receptor signaling and specifically acts on B1 cells to inhibit Ca2+ signaling, cellular expansion and antibody secretion.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 85.6 kDa
NCBI: 243958
UniProt: Q80ZE3
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTA
Target: Siglec10
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Immune Checkpoint