Recombinant Human R-spondin-2/RSPO2 Protein

Catalog Number: ABB-RP03266
Article Name: Recombinant Human R-spondin-2/RSPO2 Protein
Biozol Catalog Number: ABB-RP03266
Supplier Catalog Number: RP03266
Alternative Catalog Number: ABB-RP03266-20UG, ABB-RP03266-100UG, ABB-RP03266-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ala32-Gly205
Alternative Names: R-spondin-2, Roof plate-specific spondin-2, hRspo2,RSPO2, UNQ9384/PRO34209
R-spondins are secretory proteins localized in the endoplasmic reticulum and Golgi bodies and are processed through the secretory pathway. The RSPO family comprises four proteins, i.e., R-spondin 1-4, which are important secreted regulators of the Wnt/-catenin and Wnt/PCP signaling pathway and govern various functions and are involved in vital cellular processes such as stem cell renewal, morphogenesis and, tumorigenesis. Among the R-spondin family, R-spondin-2, is a key protein that regulates ligand-dependent -catenin signaling. And it has been reported to play a pivotal role in myogenesis, osteoblast differentiation, and limb specification during embryonic development.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 47.66 kDa
NCBI: 340419
UniProt: Q6UXX9
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG
Target: RSPO2
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors