Recombinant Human Histone H1 Protein, E. coli

Catalog Number: ABB-RP03271
Article Name: Recombinant Human Histone H1 Protein, E. coli
Biozol Catalog Number: ABB-RP03271
Supplier Catalog Number: RP03271
Alternative Catalog Number: ABB-RP03271-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Lys194
Alternative Names: Histone H1, Histone H1.0, H1-0, H1F0, H1FV, CPN60, GROEL, HLD4, HSP60, HSP65, HSPD1, HuCHA60, SPG13
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Histones H1 is the most variable histone and its role at the epigenetic level is less characterized than that of core histones. The lysine-rich H1 histone family in mammals includes eleven members. In higher eukaryotes, all H1 variants have the same general structure, consisting of a central conserved globular domain and less conserved N-terminal and C-terminal tails. These tails are moderately conserved among species, but differ among variants, suggesting a specific function for each H1 variant.
Concentration: Please contact us for more information.
Molecular Weight: 22.4 kDa
NCBI: 3005
UniProt: P07305
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 600 mM NaCl, 1 mM DTT, pH 8.5. Contact us for customized product form or formulation.
Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Target: H1-0
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 600 mM NaCl, 1 mM DTT, pH 8.5. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Reconstituted with sterile deionized water to 0.1-0.5 mg/mL. ResearchArea: Other Recombinant Protein