Recombinant Human LGR5 / GPR49 protein

Catalog Number: ABB-RP03501
Article Name: Recombinant Human LGR5 / GPR49 protein
Biozol Catalog Number: ABB-RP03501
Supplier Catalog Number: RP03501
Alternative Catalog Number: ABB-RP03501-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Immunogen: Gly 22 - Arg 561
Alternative Names: LGR5, GPR49, GPR67,Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38
LGR5 (also known as GPR49) is a seven-transmembrane protein of the class A Rhodopsin-like family of GPCRs. LGR5 and LGR4 bind the R-spondins with high affinity and mediate the potentiation of Wnt/beta-catenin signaling by enhancing Wnt-induced LRP6 phosphor
Concentration: < 1.0 EU/µg of the protein by LAL method.
Molecular Weight: 86.8 kDa
NCBI: 8549
UniProt: O75473
Purity: > 90 % as determined by SDS-PAGE
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEK
Target: LGR5
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.