Anti-ERCC8 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10020-100
Article Name: Anti-ERCC8 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10020-100
Supplier Catalog Number: A10020-100
Alternative Catalog Number: ABC-A10020-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human ERCC8 (NP_000073.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ERCC8.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 44 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: SCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
Target: ERCC8
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000