Recombinant SARS-CoV-2 Spike Protein (D614G Variant) (Functional)

Catalog Number: ABC-A122172-100
Article Name: Recombinant SARS-CoV-2 Spike Protein (D614G Variant) (Functional)
Biozol Catalog Number: ABC-A122172-100
Supplier Catalog Number: A122172-100
Alternative Catalog Number: ABC-A122172-100
Manufacturer: Antibodies.com
Category: Proteine/Peptide
Application: Functional Studies, IA, SDS-PAGE, WB
Alternative Names: sars-cov-2
Full-length soluble protein with foldon trimerization motif, mutated Furin recognition site and 2 stabilising mutations (K986P and V987P), based on/modified from Amanat et al, 2020 (PMID: 32398876).
Concentration: Lot Specific
Tag: His Tag (8xHis at the C-terminus).
Buffer: Supplied in Phosphate Buffered Saline with 20% Glycerol.
Expression System: HEK293 cells.
Purity: > 95% (by SDS-PAGE).
Form: Liquid
Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL
Target: SARS-CoV-2 Spike Protein