Anti-SARS-CoV-2 ORF7a Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A305756-100
Article Name: Anti-SARS-CoV-2 ORF7a Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A305756-100
Supplier Catalog Number: A305756-100
Alternative Catalog Number: ABC-A305756-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 ORF7a.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 17 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS
Target: SARS-CoV-2 ORF7a
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000