Anti-PCK2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A306806-100
Article Name: Anti-PCK2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A306806-100
Supplier Catalog Number: A306806-100
Alternative Catalog Number: ABC-A306806-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PEPCK/PCK2 (NP_004554.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PCK2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 71 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVQLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGG
Target: PCK2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200, IHC: 1:50-1:200, IP: 1:50-1:200