Anti-TMPRSS2 Antibody [ARC1439], Unconjugated, Rabbit, Monoclonal

Catalog Number: ABC-A306933-100
Article Name: Anti-TMPRSS2 Antibody [ARC1439], Unconjugated, Rabbit, Monoclonal
Biozol Catalog Number: ABC-A306933-100
Supplier Catalog Number: A306933-100
Alternative Catalog Number: ABC-A306933-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMPRSS2 (O15393).
Conjugation: Unconjugated
Rabbit monoclonal [ARC1439] antibody to TMPRSS2.
Clonality: Monoclonal
Concentration: Lot Specific
Clone Designation: [ARC1439]
Molecular Weight: 52 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Form: Liquid
Sequence: MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAAL
Target: TMPRSS2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200