Anti-SARS-CoV-2 Spike Glycoprotein Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A308165-100
Article Name: Anti-SARS-CoV-2 Spike Glycoprotein Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A308165-100
Supplier Catalog Number: A308165-100
Alternative Catalog Number: ABC-A308165-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: DOT, ICC, IP, WB
Species Reactivity: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (YP_009724390.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 110 kDa / 180 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: PGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLG
Target: SARS-CoV-2 Spike Glycoprotein
Antibody Type: Primary Antibody
Application Dilute: Dot Blot: 1:500-1:2,000, WB: 1:500-1:1,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000