Recombinant Human CD5 Protein (Biotin) (C-terminal Human Fc and Avi Tag)
Catalog Number:
ABC-A330362-100
| Article Name: |
Recombinant Human CD5 Protein (Biotin) (C-terminal Human Fc and Avi Tag) |
| Biozol Catalog Number: |
ABC-A330362-100 |
| Supplier Catalog Number: |
A330362-100 |
| Alternative Catalog Number: |
ABC-A330362-100 |
| Manufacturer: |
Antibodies.com |
| Category: |
Proteine/Peptide |
| Conjugation: |
Biotin |
| Concentration: |
Reconstitution dependent. |
| Tag: |
C-terminal Human Fc and Avi Tag |
| Buffer: |
Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized). |
| Expression System: |
HEK293 cells |
| Purity: |
>95% (by SDS-PAGE and HPLC). |
| Form: |
Lyophilized |
| Sequence: |
RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLV |
| Target: |
CD5 |