Recombinant Human CD5 Protein (C-terminal Human Fc and Avi Tag), Unconjugated

Catalog Number: ABC-A330363-100
Article Name: Recombinant Human CD5 Protein (C-terminal Human Fc and Avi Tag), Unconjugated
Biozol Catalog Number: ABC-A330363-100
Supplier Catalog Number: A330363-100
Alternative Catalog Number: ABC-A330363-100
Manufacturer: Antibodies.com
Category: Proteine/Peptide
Conjugation: Unconjugated
Concentration: Reconstitution dependent.
Tag: C-terminal Human Fc and Avi Tag
Buffer: Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized).
Expression System: HEK293 cells
Purity: >95% (by SDS-PAGE and HPLC).
Form: Lyophilized
Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLV
Target: CD5