Recombinant Human Cdc42 Protein (N-terminal GST Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human Cdc42 Protein (N-terminal GST Tag), Unconjugated
• Biozol Catalog Number: ABC-A330433-100
• Supplier Catalog Number: A330433-100
• Alternative Catalog Number: ABC-A330433-100
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Tag: N-terminal GST Tag
• Buffer: Lyophilized from sterile 20mM Tris, pH 8.0, with 0.15M NaCl and 0.5mM GSH.
• Expression System: Escherichia coli
• Purity: >85% (by SDS-PAGE).
• Form: Lyophilized
• Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
• Target: Cdc42