Recombinant Human IL3RA/CD123 Protein (C-terminal Human Fc Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human IL3RA/CD123 Protein (C-terminal Human Fc Tag), Unconjugated
• Biozol Catalog Number: ABC-A330906-100
• Supplier Catalog Number: A330906-100
• Alternative Catalog Number: ABC-A330906-100
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Tag: C-terminal Human Fc Tag
• Buffer: Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized).
• Expression System: HEK293 cells
• Purity: >90% (by SDS-PAGE and HPLC).
• Form: Lyophilized
• Sequence: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIR
• Target: IL3RA/CD123