Recombinant Human Intestinal Alkaline Phosphatase Protein (N-terminal His and Flag Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human Intestinal Alkaline Phosphatase Protein (N-terminal His and Flag Tag), Unconjugated
• Biozol Catalog Number: ABC-A330951-100
• Supplier Catalog Number: A330951-100
• Alternative Catalog Number: ABC-A330951-100
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Tag: N-terminal His and Flag Tag
• Expression System: HEK293 cells
• Purity: >95% (by Tris-Bis PAGE and HPLC).
• Form: Lyophilized
• Sequence: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQ
• Target: Intestinal Alkaline Phosphatase