Recombinant Human LILRB3 Protein (C-terminal His and Avi Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human LILRB3 Protein (C-terminal His and Avi Tag), Unconjugated
• Biozol Catalog Number: ABC-A331010-50
• Supplier Catalog Number: A331010-50
• Alternative Catalog Number: ABC-A331010-50
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Tag: C-terminal His and Avi Tag
• Buffer: Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized).
• Expression System: HEK293 cells
• Purity: >95% (by SDS-PAGE).
• Form: Lyophilized
• Sequence: GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQ
• Target: LILRB3