Recombinant Human CGB7 Protein (C-terminal His Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human CGB7 Protein (C-terminal His Tag), Unconjugated
• Biozol Catalog Number: ABC-A331519-100
• Supplier Catalog Number: A331519-100
• Alternative Catalog Number: ABC-A331519-100
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Tag: C-terminal His Tag
• Buffer: Lyophilized from 20mM Tris, pH 7.4, with 500mM NaCl and 10% Glycerol (0.22µm filter sterilized).
• Expression System: Baculovirus-Insect Cells
• Purity: >96% (by SEC-HPLC).
• Form: Lyophilized
• Sequence: MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Target: CGB7