Recombinant Mouse PF4 Protein (C-terminal His Tag), Unconjugated
Catalog Number:
ABC-A331552-100
| Article Name: |
Recombinant Mouse PF4 Protein (C-terminal His Tag), Unconjugated |
| Biozol Catalog Number: |
ABC-A331552-100 |
| Supplier Catalog Number: |
A331552-100 |
| Alternative Catalog Number: |
ABC-A331552-100 |
| Manufacturer: |
Antibodies.com |
| Category: |
Proteine/Peptide |
| Conjugation: |
Unconjugated |
| Concentration: |
Reconstitution dependent. |
| Tag: |
C-terminal His Tag |
| Buffer: |
Lyophilized from 20mM PB, pH 6.0, with 150mM NaCl, 1mM EDTA, and 8% Trehalose (0.22µm filter sterilized). |
| Expression System: |
Pichia |
| Purity: |
>90% (by SDS-PAGE). |
| Form: |
Lyophilized |
| Sequence: |
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES |
| Target: |
PF4 |