Recombinant Mouse PF4 Protein (C-terminal His Tag), Unconjugated

Product Overview

• Article Name: Recombinant Mouse PF4 Protein (C-terminal His Tag), Unconjugated
• Biozol Catalog Number: ABC-A331552-20
• Supplier Catalog Number: A331552-20
• Alternative Catalog Number: ABC-A331552-20
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Tag: C-terminal His Tag
• Buffer: Lyophilized from 20mM PB, pH 6.0, with 150mM NaCl, 1mM EDTA, and 8% Trehalose (0.22µm filter sterilized).
• Expression System: Pichia
• Purity: >90% (by SDS-PAGE).
• Form: Lyophilized
• Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
• Target: PF4