Recombinant Mouse TIM 3 Protein (C-terminal Human Fc and His Tag), Unconjugated
Catalog Number:
ABC-A331880-50
| Article Name: |
Recombinant Mouse TIM 3 Protein (C-terminal Human Fc and His Tag), Unconjugated |
| Biozol Catalog Number: |
ABC-A331880-50 |
| Supplier Catalog Number: |
A331880-50 |
| Alternative Catalog Number: |
ABC-A331880-50 |
| Manufacturer: |
Antibodies.com |
| Category: |
Proteine/Peptide |
| Conjugation: |
Unconjugated |
| Concentration: |
Reconstitution dependent. |
| Tag: |
C-terminal Human Fc and His Tag |
| Buffer: |
Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Expression System: |
HEK293 cells |
| Purity: |
>95% (by SDS-PAGE). |
| Form: |
Lyophilized |
| Sequence: |
RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR |
| Target: |
TIM 3 |