Recombinant Human TMPO Protein (C-terminal His Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human TMPO Protein (C-terminal His Tag), Unconjugated
• Biozol Catalog Number: ABC-A331882-10
• Supplier Catalog Number: A331882-10
• Alternative Catalog Number: ABC-A331882-10
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Tag: C-terminal His Tag
• Buffer: Lyophilized from 20mM PB, pH 7.4, with 150mM NaCl and without preservatives or carriers (0.2µm filter sterilized).
• Expression System: Escherichia coli
• Purity: >95% (by SDS-PAGE).
• Form: Lyophilized
• Sequence: PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
• Target: TMPO