Recombinant Human IL-29 Protein (C-terminal hFc Tag), Unconjugated
Catalog Number:
ABC-A332851-100
| Article Name: |
Recombinant Human IL-29 Protein (C-terminal hFc Tag), Unconjugated |
| Biozol Catalog Number: |
ABC-A332851-100 |
| Supplier Catalog Number: |
A332851-100 |
| Alternative Catalog Number: |
ABC-A332851-100 |
| Manufacturer: |
Antibodies.com |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Conjugation: |
Unconjugated |
| Concentration: |
Reconstitution dependent. |
| Molecular Weight: |
35-70 kDa due to glycosylation. |
| Tag: |
C-terminal Human Fc Tag |
| Buffer: |
Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%-8% Trehalose is added as a protectant before lyophilization. |
| Expression System: |
HEK293 cells |
| Purity: |
>95% as determined by SDS-PAGE and Coomassie blue staining. |
| Form: |
Lyophilized |
| Sequence: |
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
| Target: |
IL-29 |