Recombinant Human Oncostatin M/OSM Protein (C-terminal 10xHis Tag), Unconjugated

Catalog Number: ABC-A332863-50
Article Name: Recombinant Human Oncostatin M/OSM Protein (C-terminal 10xHis Tag), Unconjugated
Biozol Catalog Number: ABC-A332863-50
Supplier Catalog Number: A332863-50
Alternative Catalog Number: ABC-A332863-50
Manufacturer: Antibodies.com
Category: Proteine/Peptide
Application: SDS-PAGE
Conjugation: Unconjugated
Concentration: Reconstitution dependent.
Molecular Weight: 25-35 kDa due to glycosylation.
Tag: C-terminal 10xHis Tag
Buffer: Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%-8% Trehalose is added as a protectant before lyophilization.
Expression System: HEK293 cells
Purity: >85% as determined by SDS-PAGE and Coomassie blue staining.
Form: Lyophilized
Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Target: Oncostatin M/OSM