Recombinant Human IFNGR1 Protein (C-terminal 10xHis Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human IFNGR1 Protein (C-terminal 10xHis Tag), Unconjugated
• Biozol Catalog Number: ABC-A332871-50
• Supplier Catalog Number: A332871-50
• Alternative Catalog Number: ABC-A332871-50
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Molecular Weight: 35-55 kDa due to glycosylation.
• Tag: C-terminal 10xHis Tag
• Buffer: Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%-8% Trehalose is added as a protectant before lyophilization.
• Expression System: HEK293 cells
• Purity: >85% as determined by SDS-PAGE and Coomassie blue staining.
• Form: Lyophilized
• Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
• Target: IFNGR1