Recombinant Human SLC44A4 Protein (N-terminal hFc Tag), Unconjugated

Product Overview

• Article Name: Recombinant Human SLC44A4 Protein (N-terminal hFc Tag), Unconjugated
• Biozol Catalog Number: ABC-A332873-100
• Supplier Catalog Number: A332873-100
• Alternative Catalog Number: ABC-A332873-100
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Conjugation: Unconjugated

Product Properties

• Concentration: Reconstitution dependent.
• Molecular Weight: 55-70 kDa due to glycosylation.
• Tag: N-terminal Human Fc Tag
• Buffer: Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%-8% Trehalose is added as a protectant before lyophilization.
• Expression System: HEK293 cells
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining.
• Form: Lyophilized
• Sequence: GDPRQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFEDFAQ
• Target: SLC44A4