Recombinant Human Resistin Protein (N-terminal His Tag)
Catalog Number:
ABC-A61404-1
- Images (0)
| Article Name: | Recombinant Human Resistin Protein (N-terminal His Tag) |
| Biozol Catalog Number: | ABC-A61404-1 |
| Supplier Catalog Number: | A61404-1 |
| Alternative Catalog Number: | ABC-A61404-1 |
| Manufacturer: | Antibodies.com |
| Category: | Proteine/Peptide |
| Application: | SDS-PAGE |
| Concentration: | Lot Specific |
| Tag: | N-terminal His Tag |
| Buffer: | Supplied in 20 mM Tris HCl Buffer, pH 8, with 5 mM EDTA and 50% Glycerol. |
| Expression System: | Escherichia coli |
| Purity: | >95% as determined by SDS-PAGE. |
| Form: | Liquid |
| Sequence: | SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
| Target: | Resistin |
Product Guarantee and Expert Support
