Recombinant Human Apo-D Protein (GST Tag)
Catalog Number:
ABC-A61482-2
| Article Name: |
Recombinant Human Apo-D Protein (GST Tag) |
| Biozol Catalog Number: |
ABC-A61482-2 |
| Supplier Catalog Number: |
A61482-2 |
| Alternative Catalog Number: |
ABC-A61482-2 |
| Manufacturer: |
Antibodies.com |
| Category: |
Proteine/Peptide |
| Concentration: |
Lot Specific |
| Tag: |
GST Tag |
| Buffer: |
Supplied in 50 mM Tris Acetate Buffer, pH 7.5, with 1 mM EDTA and 20% Glycerol. |
| Expression System: |
Escherichia coli |
| Form: |
Liquid |
| Sequence: |
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS |
| Target: |
Apo-D |