Recombinant Human IL-17A Protein (N-terminal His Tag)

Product Overview

• Article Name: Recombinant Human IL-17A Protein (N-terminal His Tag)
• Biozol Catalog Number: ABC-A61484-2
• Supplier Catalog Number: A61484-2
• Alternative Catalog Number: ABC-A61484-2
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Application: SDS-PAGE

Product Properties

• Concentration: 0.171mg/ml
• Tag: N-terminal His Tag
• Buffer: Supplied at pH 4.8 with 25 mM Sodium Acetate and 50% Glycerol.
• Expression System: Escherichia coli
• Purity: >95% as determined by SDS-PAGE.
• Form: Liquid
• Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
• Target: IL-17A