Recombinant Human IL-33 Protein (C-terminal His Tag)

Product Overview

• Article Name: Recombinant Human IL-33 Protein (C-terminal His Tag)
• Biozol Catalog Number: ABC-A61486-2
• Supplier Catalog Number: A61486-2
• Alternative Catalog Number: ABC-A61486-2
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Application: SDS-PAGE

Product Properties

• Concentration: Lot Specific
• Tag: C-terminal His Tag
• Buffer: Supplied in 10 mM Tris HCl Buffer, pH 8, with 180 mM Sodium Chloride and 50% Glycerol.
• Expression System: Escherichia coli
• Purity: >90% as determined by SDS-PAGE.
• Form: Liquid
• Sequence: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
• Target: IL-33