Recombinant Human Prolactin/PRL Protein (N-terminal His Tag)

Product Overview

• Article Name: Recombinant Human Prolactin/PRL Protein (N-terminal His Tag)
• Biozol Catalog Number: ABC-A63102-20
• Supplier Catalog Number: A63102-20
• Alternative Catalog Number: ABC-A63102-20
• Manufacturer: Antibodies.com
• Category: Proteine/Peptide
• Application: SDS-PAGE

Product Properties

• Concentration: Lot Specific
• Tag: N-terminal His Tag
• Buffer: Supplied in Phosphate Buffered Saline with 50% Glycerol.
• Expression System: Escherichia coli
• Purity: >95% as determined by RP-HPLC and SDS-PAGE.
• Form: Liquid
• Sequence: LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
• Target: Prolactin/PRL