Anti-alpha Tubulin Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80425-100
Article Name: Anti-alpha Tubulin Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80425-100
Supplier Catalog Number: A80425-100
Alternative Catalog Number: ABC-A80425-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human a-Tubulin (P68366).
Conjugation: Unconjugated
Rabbit polyclonal antibody to alpha Tubulin.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 55 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
Target: alpha Tubulin
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:25-1:50, ICC/IF: 1:50-1:200