Anti-DMP1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80585-100
Article Name: Anti-DMP1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80585-100
Supplier Catalog Number: A80585-100
Alternative Catalog Number: ABC-A80585-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human, Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 254-513 of human DMP1.
Conjugation: Unconjugated
Rabbit polyclonal antibody to DMP1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 68 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: SGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQENSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPESPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQLKNIEIESRKLTVDAYHNKPIGDQDDND
Target: DMP1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000