Anti-LC3B Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80596-100
Article Name: Anti-LC3B Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80596-100
Supplier Catalog Number: A80596-100
Alternative Catalog Number: ABC-A80596-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (NP_073729.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to LC3B.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 14 kDa / 16 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Target: LC3B
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200