Anti-SEC61A Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80629-100
Article Name: Anti-SEC61A Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80629-100
Supplier Catalog Number: A80629-100
Alternative Catalog Number: ABC-A80629-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 310-420 of human SEC61A.
Conjugation: Unconjugated
Rabbit polyclonal antibody to SEC61A.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 52 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: ARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
Target: SEC61A
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000