Anti-NKCC1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80631-100
Article Name: Anti-NKCC1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80631-100
Supplier Catalog Number: A80631-100
Alternative Catalog Number: ABC-A80631-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-280 of human SLC12A2 (NP_001037.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NKCC1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 160 - 200 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: YDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK
Target: NKCC1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200