Anti-RNA polymerase II CTD repeat YSPTSPS Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80664-100
Article Name: Anti-RNA polymerase II CTD repeat YSPTSPS Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80664-100
Supplier Catalog Number: A80664-100
Alternative Catalog Number: ABC-A80664-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ChIP, IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human POLR2A (NP_000928.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to RNA polymerase II CTD repeat YSPTSPS.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 250 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: KRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAG
Target: RNA polymerase II CTD repeat YSPTSPS
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200, ChIP: 1:20-1:50