Anti-PCSK9 Antibody [ARC50558], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A80681-100
| Article Name: |
Anti-PCSK9 Antibody [ARC50558], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A80681-100 |
| Supplier Catalog Number: |
A80681-100 |
| Alternative Catalog Number: |
ABC-A80681-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC50558] antibody to PCSK9. |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC50558] |
| Molecular Weight: |
65 kDa / 80 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ |
| Target: |
PCSK9 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:1,000 |
