Anti-FBP1 Antibody [ARC0664], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A80698-100
| Article Name: |
Anti-FBP1 Antibody [ARC0664], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A80698-100 |
| Supplier Catalog Number: |
A80698-100 |
| Alternative Catalog Number: |
ABC-A80698-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 239-338 of human FBP1 (P09467). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0664] antibody to FBP1. |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC0664] |
| Molecular Weight: |
40 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
APYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ |
| Target: |
FBP1 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2,000, ICC/IF: 1:50-1:200 |
