Anti-Caspase-8 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80797-100
Article Name: Anti-Caspase-8 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80797-100
Supplier Catalog Number: A80797-100
Alternative Catalog Number: ABC-A80797-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 4-480 of mouse Caspase 8 (O89110).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Caspase-8.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 57 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: FEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP
Target: Caspase-8
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200