Anti-GRP78 BiP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80803-100
Article Name: Anti-GRP78 BiP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80803-100
Supplier Catalog Number: A80803-100
Alternative Catalog Number: ABC-A80803-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-654 of human BiP/GRP78 (NP_005338.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GRP78 BiP.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 72 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL
Target: GRP78 BiP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200