Anti-AMID Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80936-100
Article Name: Anti-AMID Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80936-100
Supplier Catalog Number: A80936-100
Alternative Catalog Number: ABC-A80936-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 43-371 of human AIFM2/AMID/AMID (NP_116186.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to AMID.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 41 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: KDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYL
Target: AMID
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000