Anti-PFDN2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80983-100
Article Name: Anti-PFDN2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80983-100
Supplier Catalog Number: A80983-100
Alternative Catalog Number: ABC-A80983-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human PFDN2 (NP_036526.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PFDN2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 17 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Target: PFDN2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:5,000, IHC: 1:100-1:200