Anti-IL-6 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A81218-100
Article Name: Anti-IL-6 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A81218-100
Supplier Catalog Number: A81218-100
Alternative Catalog Number: ABC-A81218-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 30-212 of human IL6 (NP_000591.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to IL-6.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 24kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Target: IL-6
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1000, IHC-P: 1:50-1:100, ELISA: 1 µg/ml (starting concentration)