Anti-Fibulin-4 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8507-100
Article Name: Anti-Fibulin-4 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8507-100
Supplier Catalog Number: A8507-100
Alternative Catalog Number: ABC-A8507-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-250 of human EFEMP2 (NP_058634.4).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Fibulin-4.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 55 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: SPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYS
Target: Fibulin-4
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000