Anti-GFP Antibody, Unconjugated, Gallus, Polyclonal

Catalog Number: ABC-A85300-100
Article Name: Anti-GFP Antibody, Unconjugated, Gallus, Polyclonal
Biozol Catalog Number: ABC-A85300-100
Supplier Catalog Number: A85300-100
Alternative Catalog Number: ABC-A85300-100
Manufacturer: Antibodies.com
Host: Gallus
Category: Antikörper
Application: ICC, IHC, WB
Immunogen: Recombinant Aequoria coerulescens GFP protein, expressed in and purified from E. coli.
Conjugation: Unconjugated
Chicken polyclonal antibody to GFP.
Clonality: Polyclonal
Concentration: 1 mg/ml
Molecular Weight: 27 kDa
Buffer: Supplied in Phosphate Buffered Saline with 50% Glycerol and 5mM Sodium Azide.
Form: Liquid
Sequence: MVSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYK
Target: GFP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:5,000, ICC/IF: 1:1,000-1:5,000, IHC: 1:1,000-1:5,000